DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and Gata5

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001019487.1 Gene:Gata5 / 499951 RGDID:1561365 Length:404 Species:Rattus norvegicus


Alignment Length:317 Identity:127/317 - (40%)
Similarity:154/317 - (48%) Gaps:87/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 AAAASLSAAVAASAATSSNGLFDGTAQ----------AYSSGGSGGGGGGGSGSGGYDTSSYASY 358
            ||.:|.:.||:|.::...:|.....|.          |:|..|||.||..|...|       |::
  Rat    59 AAHSSWTQAVSAESSAFGSGSPHPPATHPPGATAFPFAHSPSGSGSGGSAGVRDG-------AAF 116

  Fly   359 HHAAAHHQAAAVAAANMFQSS--SVAAAAVRHSMAAAQAHHHHHHHHSGHHHSG--SSSGLHGLG 419
            ..|....:....|......:|  :...|.|...:|.:..             ||  .||.||||.
  Rat   117 QSALLAREQYPTALGRPMSASYPTTYPAYVSPDVAPSWT-------------SGPFDSSILHGLQ 168

  Fly   420 GSVGGTAGMGSMSGNSGGAGSLSGHSGAGSNAGSNCLDVKPVRTKPRTS----------AEGREC 474
            |..||..|.                                     ||:          .|||||
  Rat   169 GRPGGLPGR-------------------------------------RTTFVPDFLEEFPGEGREC 196

  Fly   475 VNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKT 539
            |||||.|||||||||||||||||||||:||||.||||::|::||      |:::|:|..|:||.|
  Rat   197 VNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRL------SSSRRSGLCCSNCHT 255

  Fly   540 TTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKLSSKSKKKKGLG 596
            .|||||||||.|||||||||||.|||.|.|||.||||.||||.||..:.:|.|...|
  Rat   256 ATTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKNPAKIKGSSG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 40/46 (87%)
ZnF_GATA 473..517 CDD:238123 37/43 (86%)
ZnF_GATA 529..578 CDD:214648 37/48 (77%)
ZnF_GATA 533..583 CDD:238123 39/49 (80%)
Gata5NP_001019487.1 GATA-N 1..181 CDD:283099 38/178 (21%)
ZnF_GATA 191..236 CDD:214648 39/44 (89%)
ZnF_GATA 195..239 CDD:238123 37/43 (86%)
ZnF_GATA 245..294 CDD:214648 37/48 (77%)
ZnF_GATA 250..300 CDD:238123 39/49 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.