powered by:
Protein Alignment grn and med-1
DIOPT Version :9
Sequence 1: | NP_001262366.1 |
Gene: | grn / 40962 |
FlyBaseID: | FBgn0001138 |
Length: | 712 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001366746.1 |
Gene: | med-1 / 191705 |
WormBaseID: | WBGene00003180 |
Length: | 174 |
Species: | Caenorhabditis elegans |
Alignment Length: | 56 |
Identity: | 21/56 - (37%) |
Similarity: | 29/56 - (51%) |
Gaps: | 7/56 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 534 CANCKTTTTTLWRRNASGEPV-CNACGLYYKLHNVNRPLT------MKKEGIQTRN 582
|:||..|.|..||...|.|.: ||||.:|.:.:|..||:| .:|..:|..|
Worm 114 CSNCSVTETIRWRNIRSKEGIQCNACFIYQRKYNKTRPVTAVNKYQKRKLKVQETN 169
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5641 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10071 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.