DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and elt-2

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_509755.2 Gene:elt-2 / 181250 WormBaseID:WBGene00001250 Length:433 Species:Caenorhabditis elegans


Alignment Length:188 Identity:68/188 - (36%)
Similarity:88/188 - (46%) Gaps:48/188 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 GSLSGHSGAGSNAGSNCLDVKPVRTKPR-----------TSAEGRECVNCGATSTPLWRRDGTGH 492
            |:.||:        :|.:..||....|.           |.|...|||.| :.|.....:...|.
 Worm   115 GTFSGY--------TNSIYDKPSLYDPSIPTINIPSTYPTVAPTYECVKC-SQSCGAGMKAVNGG 170

  Fly   493 YLCNACG----------LYYKMNGQ----NRPLIKPKRRLTLQSLQ-----------SAAKRAGT 532
            .:|..|.          .|....||    ..|..:|..::..||.:           ||::|.|.
 Worm   171 MMCVNCSTPKTTYSPPVAYSTSLGQPPILEIPSEQPTAKIAKQSSKKSSSSNRGSNGSASRRQGL 235

  Fly   533 SCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEG-IQTRNRKLSSKS 589
            .|:||..|.||||||||.|:|||||||||:|||::.||.:||||| :|||.||  |||
 Worm   236 VCSNCNGTNTTLWRRNAEGDPVCNACGLYFKLHHIPRPTSMKKEGALQTRKRK--SKS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 13/60 (22%)
ZnF_GATA 473..517 CDD:238123 13/57 (23%)
ZnF_GATA 529..578 CDD:214648 34/49 (69%)
ZnF_GATA 533..583 CDD:238123 35/50 (70%)
elt-2NP_509755.2 ZnF_GATA 232..280 CDD:214648 32/47 (68%)
ZnF_GATA 236..288 CDD:238123 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.