DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and Zglp1

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:XP_006242739.1 Gene:Zglp1 / 100360291 RGDID:2322460 Length:326 Species:Rattus norvegicus


Alignment Length:126 Identity:35/126 - (27%)
Similarity:45/126 - (35%) Gaps:46/126 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   452 GSNCLDVKPVRTKP--------RTSAEG-RECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQ 507
            |.:|....|  |.|        .|.|.| |.|.:|....|||||....|..||||||:.|     
  Rat   228 GRSCSQKLP--TSPSKALASPGSTEALGPRRCASCRTQRTPLWRDAEDGTPLCNACGIRY----- 285

  Fly   508 NRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLW---RRNASGEPVCNACGLYYKLH 565
                                |:.||.|::|       |   |::.....:|..||:....|
  Rat   286 --------------------KKYGTRCSSC-------WLVPRKSIQPRRLCGRCGVSQDPH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 17/47 (36%)
ZnF_GATA 473..517 CDD:238123 15/43 (35%)
ZnF_GATA 529..578 CDD:214648 10/40 (25%)
ZnF_GATA 533..583 CDD:238123 8/36 (22%)
Zglp1XP_006242739.1 ZnF_GATA 254..>291 CDD:214648 18/61 (30%)
GATA 257..291 CDD:278735 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.