DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment grn and ZGLP1

DIOPT Version :9

Sequence 1:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_001096637.1 Gene:ZGLP1 / 100125288 HGNCID:37245 Length:271 Species:Homo sapiens


Alignment Length:153 Identity:42/153 - (27%)
Similarity:53/153 - (34%) Gaps:62/153 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 SSSGLHGLGGSVGGTAGMGSMSGNSGGAGSLSGHSGAGSNAGSNCLDVKPVRTKPRTSAEGRECV 475
            ||........:|||.|      .:.||.   ..||     |||..|             |.|.|.
Human   170 SSRSQESPADAVGGPA------AHPGGT---EAHS-----AGSEAL-------------EPRRCA 207

  Fly   476 NCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTT 540
            :|....|||||....|..||||||:.|                         |:.||.|::|   
Human   208 SCRTQRTPLWRDAEDGTPLCNACGIRY-------------------------KKYGTRCSSC--- 244

  Fly   541 TTTLW---RRNASGEPVCNACGL 560
                |   |:|...:.:|..||:
Human   245 ----WLVPRKNVQPKRLCGRCGV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
grnNP_001262366.1 ZnF_GATA 470..517 CDD:214648 17/46 (37%)
ZnF_GATA 473..517 CDD:238123 15/43 (35%)
ZnF_GATA 529..578 CDD:214648 10/35 (29%)
ZnF_GATA 533..583 CDD:238123 8/31 (26%)
ZGLP1NP_001096637.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..141
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..199 12/42 (29%)
ZnF_GATA 202..>240 CDD:214648 19/62 (31%)
GATA 206..240 CDD:278735 17/58 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.