DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and ARLA1D

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_569051.1 Gene:ARLA1D / 836892 AraportID:AT5G67560 Length:184 Species:Arabidopsis thaliana


Alignment Length:184 Identity:114/184 - (61%)
Similarity:148/184 - (80%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVT 66
            :.|.:.:|.|.:|:|:|:||||:|:|||.:|||:.|||:|:|.::|||||||||||||:|:|:||
plant     1 MGLWDALLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVVATGGYSEDMIPTVGFNMRKVTKGSVT 65

  Fly    67 IKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNK 131
            ||:||:|||||||||||||||.|:||||:|||||.|.|..|::|||.||.|..|.|||:||||||
plant    66 IKLWDLGGQPRFRSMWERYCRSVSAIVYVVDAADPDNLSVSKSELHDLLSKTSLNGIPLLVLGNK 130

  Fly   132 RDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQS 185
            .|.||||.:..|.:.|.|.|:.|||:||:.||||...|||..:.||::||||.:
plant   131 IDKPGALSKEALTDEMGLKSLTDREVCCFMISCKNSTNIDQVIDWLVKHSKSSN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 102/157 (65%)
ARLA1DNP_569051.1 Arl10_like 21..179 CDD:206724 102/157 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 238 1.000 Domainoid score I596
eggNOG 1 0.900 - - E2759_KOG0075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I1003
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 1 1.000 - - otm2440
orthoMCL 1 0.900 - - OOG6_101541
Panther 1 1.100 - - O PTHR45732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.