DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and ARLA1B

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_190555.2 Gene:ARLA1B / 824148 AraportID:AT3G49860 Length:176 Species:Arabidopsis thaliana


Alignment Length:167 Identity:104/167 - (62%)
Similarity:129/167 - (77%) Gaps:0/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWE 83
            :||||:|||||.||||:.|||:|:|:::|||||||||||||:|:.||.|::||:|||||||.|||
plant    10 KEMELSLVGLQNSGKTSLVNVVATGEYSEDMIPTVGFNMRKVTKENVAIRLWDLGGQPRFRCMWE 74

  Fly    84 RYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMN 148
            ||||.|:.|||:|||||.:.|..||:|||.||....|.|||:||||||.|:.|||.:..|.|.|.
plant    75 RYCRAVSMIVYVVDAADTENLSVSRSELHDLLSNASLIGIPLLVLGNKIDIHGALSKEALTEEMG 139

  Fly   149 LSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQS 185
            |||:..||:||..||||....||....||:.||||::
plant   140 LSSVTSREVCCLMISCKNPTTIDQLTDWLVNHSKSKN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 98/157 (62%)
ARLA1BNP_190555.2 Arl10_like 13..171 CDD:206724 98/157 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 238 1.000 Domainoid score I596
eggNOG 1 0.900 - - E2759_KOG0075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I1003
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2440
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.