DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and ARFC1

DIOPT Version :10

Sequence 1:NP_649769.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_188935.1 Gene:ARFC1 / 821868 AraportID:AT3G22950 Length:183 Species:Arabidopsis thaliana


Alignment Length:150 Identity:50/150 - (33%)
Similarity:84/150 - (56%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FKSIFW-----KEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWD 71
            |.|.||     .:|.::.:|||..:||||.:..:..|:..... ||||.|:.::...|:..:|||
plant     4 FMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTH-PTVGSNVEELVYKNIRFEVWD 67

  Fly    72 IGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPG 136
            :|||.|.|:.|..|.||.:|::.::|:.|..::...::||..||....|....:||..||:||..
plant    68 LGGQDRLRTSWATYYRGTHAVIVVIDSTDRARISFMKDELARLLGHEDLQNSVILVFANKQDLKD 132

  Fly   137 ALDETGLIERMNLSSIQDRE 156
            |:....:.:.:||.||::.:
plant   133 AMTPAEITDALNLHSIKNHD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_649769.1 Arl10_like 22..180 CDD:206724 45/134 (34%)
ARFC1NP_188935.1 Arl5_Arl8 3..176 CDD:133353 50/149 (34%)

Return to query results.
Submit another query.