DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and AT2G18770

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001323846.1 Gene:AT2G18770 / 816392 AraportID:AT2G18770 Length:270 Species:Arabidopsis thaliana


Alignment Length:148 Identity:42/148 - (28%)
Similarity:62/148 - (41%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSI--FWKEEMELTLV-GLQFSGKTTFVNVIASGQFAE----DMIPTVG---- 54
            :||.|     |..||  |.:.:....|: ||..||||.....:..|...:    .|.|..|    
plant    48 LLATI-----WLLSIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVL 107

  Fly    55 FNMRKITRGNV-TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAAD-LDKLEASRNELHSLLDK 117
            .|.....:|.| .:.:.|:.|..|..|..|.|.....|:|::|||.: |..:.|:...|:.:|..
plant   108 HNENNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTN 172

  Fly   118 PQLA--GIPVLVLGNKRD 133
            ..:.  ..|||:..||.|
plant   173 ASVIKNKTPVLLCCNKTD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 35/125 (28%)
AT2G18770NP_001323846.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.