DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and Arl8a

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_081099.1 Gene:Arl8a / 68724 MGIID:1915974 Length:186 Species:Mus musculus


Alignment Length:184 Identity:160/184 - (86%)
Similarity:177/184 - (96%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNV 65
            |:||.|::|:|||::||||||||||||||:|||||||||||||||.|||||||||||||||:|||
Mouse     1 MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNV 65

  Fly    66 TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGN 130
            |||:||||||||||||||||||||:||||||||||.:|:|||:||||:|||||||.|||||||||
Mouse    66 TIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGN 130

  Fly   131 KRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184
            ||||.|||||..|||:||||:||||||||||||||||||||||||||||||||:
Mouse   131 KRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 141/157 (90%)
Arl8aNP_081099.1 Arl10_like 22..180 CDD:206724 141/157 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 316 1.000 Domainoid score I1272
eggNOG 1 0.900 - - E2759_KOG0075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 344 1.000 Inparanoid score I2312
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 1 1.000 - - otm44217
orthoMCL 1 0.900 - - OOG6_101541
Panther 1 1.100 - - LDO PTHR45732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3186
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.