DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and Arl10

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_064352.2 Gene:Arl10 / 56795 MGIID:1930788 Length:243 Species:Mus musculus


Alignment Length:141 Identity:50/141 - (35%)
Similarity:83/141 - (58%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWE 83
            |:.|:.::||..|||:||:.::|.....|..:||.|||..::...|..:.:.:|||....|..|:
Mouse    75 EQREVLVLGLDGSGKSTFLRMLAGKPPVEGHVPTWGFNSVRLPTKNFEVDLLEIGGSQNLRFYWK 139

  Fly    84 RYCRGVNAIVYMVDAADLDKLEASRNELHSLLDK-PQLAGIPVLVLGNKRDLPGALDETGLIERM 147
            .:...|:.:|:|||:.|..:|..:|.||..|||: |.|   ||:::.||:||.||::...|.:.:
Mouse   140 EFVNEVDVLVFMVDSTDRLRLPWARQELQKLLDRDPDL---PVVIVANKQDLSGAMNMVELQQEL 201

  Fly   148 N-LSSIQDREI 157
            . |:|...||:
Mouse   202 GLLASYNQREV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 49/138 (36%)
Arl10NP_064352.2 P-loop_NTPase 78..236 CDD:393306 49/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.