DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and arl8a

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001186949.1 Gene:arl8a / 567222 ZFINID:ZDB-GENE-030131-5025 Length:186 Species:Danio rerio


Alignment Length:184 Identity:160/184 - (86%)
Similarity:179/184 - (97%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNV 65
            |:||.|::|:|||::||||||||||||||:|||||||||||||||:|||||||||||||||:|||
Zfish     1 MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKITKGNV 65

  Fly    66 TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGN 130
            |||:||||||||||||||||||||:||||||||||.:|:|||:||||:|||||||.|||||||||
Zfish    66 TIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADPEKIEASKNELHNLLDKPQLQGIPVLVLGN 130

  Fly   131 KRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184
            ||||||||||..||||||||:||||||||||||||||||||||||||||||:::
Zfish   131 KRDLPGALDEKELIERMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSRTR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 143/157 (91%)
arl8aNP_001186949.1 Arl10_like 22..180 CDD:206724 143/157 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 316 1.000 Domainoid score I1246
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 346 1.000 Inparanoid score I2286
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 1 1.000 - - otm25836
orthoMCL 1 0.900 - - OOG6_101541
Panther 1 1.100 - - LDO PTHR45732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3186
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.