DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and arl8bb

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001313407.1 Gene:arl8bb / 562445 ZFINID:ZDB-GENE-080516-10 Length:186 Species:Danio rerio


Alignment Length:184 Identity:157/184 - (85%)
Similarity:175/184 - (95%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNV 65
            ||:|.:|:|:|.:|:||||||||||||||:|||||||||||||||.|||||||||||||:|:|||
Zfish     1 MLSLFHRLLDWIRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKVTKGNV 65

  Fly    66 TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGN 130
            |||:|||||||||||||||||||||||||||||||.:|:||||||||:|||||||.|||||||||
Zfish    66 TIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKVEASRNELHNLLDKPQLQGIPVLVLGN 130

  Fly   131 KRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184
            ||||..||||..|||::|||:|||||||||||||||:||||||||||||||||:
Zfish   131 KRDLASALDEKQLIEKLNLSAIQDREICCYSISCKEQDNIDITLQWLIQHSKSR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 139/157 (89%)
arl8bbNP_001313407.1 Arl10_like 22..180 CDD:206724 139/157 (89%)
Ras 23..179 CDD:278499 137/155 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 316 1.000 Domainoid score I1246
eggNOG 1 0.900 - - E2759_KOG0075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 346 1.000 Inparanoid score I2286
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 1 1.000 - - otm25836
orthoMCL 1 0.900 - - OOG6_101541
Panther 1 1.100 - - O PTHR45732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.