DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and ARL8B

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_060654.1 Gene:ARL8B / 55207 HGNCID:25564 Length:186 Species:Homo sapiens


Alignment Length:184 Identity:162/184 - (88%)
Similarity:179/184 - (97%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNV 65
            |||||:|:|:||:|:||||||||||||||:|||||||||||||||:|||||||||||||:|:|||
Human     1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNV 65

  Fly    66 TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGN 130
            |||:||||||||||||||||||||||||||:||||.:|:||||||||:|||||||.|||||||||
Human    66 TIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGN 130

  Fly   131 KRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184
            |||||.||||..|||:||||:||||||||||||||||||||||||||||||||:
Human   131 KRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 141/157 (90%)
ARL8BNP_060654.1 Arl10_like 22..180 CDD:206724 141/157 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 316 1.000 Domainoid score I1271
eggNOG 1 0.900 - - E2759_KOG0075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 344 1.000 Inparanoid score I2327
Isobase 1 0.950 - 0 Normalized mean entropy S405
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 1 1.000 - - otm42163
orthoMCL 1 0.900 - - OOG6_101541
Panther 1 1.100 - - O PTHR45732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3186
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.820

Return to query results.
Submit another query.