DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and arl10b

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001016111.1 Gene:arl10b / 548865 XenbaseID:XB-GENE-947799 Length:186 Species:Xenopus tropicalis


Alignment Length:184 Identity:163/184 - (88%)
Similarity:178/184 - (96%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNV 65
            ||||||::|:||||:||||||||||||||:|||||||||||||||.|||||||||||||:|:|||
 Frog     1 MLALINKLLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFTEDMIPTVGFNMRKVTKGNV 65

  Fly    66 TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGN 130
            ||||||||||||||||||||||||||:|||||||||||:|||:.|||:|||||||.|||||||||
 Frog    66 TIKVWDIGGQPRFRSMWERYCRGVNAVVYMVDAADLDKVEASKYELHNLLDKPQLHGIPVLVLGN 130

  Fly   131 KRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184
            |||||.||||..|||::|||:||||||||||||||||||||||||||||||||:
 Frog   131 KRDLPNALDEKQLIEKLNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 141/157 (90%)
arl10bNP_001016111.1 Arl10_like 22..180 CDD:206724 141/157 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H131104
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.