DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and CG17819

DIOPT Version :10

Sequence 1:NP_649769.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster


Alignment Length:160 Identity:41/160 - (25%)
Similarity:83/160 - (51%) Gaps:10/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTLVGLQFSGKTTFVNVIA---SGQFAE--DMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMW 82
            |.::||..:||:|..:.:|   :|:..|  :.:....|     |..|..:::|||.|:.:.|.:|
  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSF-----TINNFRVQLWDINGELKNRQIW 82

  Fly    83 ERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERM 147
            .:|.:.||.:::::|:.|..:|..:|..|..:|...:|...|:|::.||:|..|:|..:.:|:.|
  Fly    83 PKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDLM 147

  Fly   148 NLSSIQDREICCYSISCKEKDNIDITLQWL 177
            .|..:..|:......|.:....:...:.|:
  Fly   148 GLYRLTGRDWTFEECSMRTGSGVQEIVNWI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_649769.1 Arl10_like 22..180 CDD:206724 41/160 (26%)
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 41/160 (26%)

Return to query results.
Submit another query.