DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and CG17819

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster


Alignment Length:160 Identity:41/160 - (25%)
Similarity:83/160 - (51%) Gaps:10/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTLVGLQFSGKTTFVNVIA---SGQFAE--DMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMW 82
            |.::||..:||:|..:.:|   :|:..|  :.:....|     |..|..:::|||.|:.:.|.:|
  Fly    23 LLILGLDNAGKSTLTDRLAEIFNGESKESNNQVSEWSF-----TINNFRVQLWDINGELKNRQIW 82

  Fly    83 ERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERM 147
            .:|.:.||.:::::|:.|..:|..:|..|..:|...:|...|:|::.||:|..|:|..:.:|:.|
  Fly    83 PKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASGSLSMSTVIDLM 147

  Fly   148 NLSSIQDREICCYSISCKEKDNIDITLQWL 177
            .|..:..|:......|.:....:...:.|:
  Fly   148 GLYRLTGRDWTFEECSMRTGSGVQEIVNWI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 41/160 (26%)
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 41/160 (26%)
Ras 23..183 CDD:278499 41/160 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.