DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and Arl6

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster


Alignment Length:187 Identity:55/187 - (29%)
Similarity:99/187 - (52%) Gaps:20/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KEEMELTLVGLQFSGKTTFVNVI-ASGQFAEDMIPTVGFNMRK--ITRGNVTIKVWDIGGQPRFR 79
            |::|.:.::||..|||::.:|.. .|.:....::|||||.:.:  |....|:||..|:.|..|:|
  Fly    15 KDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMSGVSIKAIDMSGATRYR 79

  Fly    80 SMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAG--IPVLVLGNKRDLPGALDETG 142
            ::||...:..:.|:|::|::|..:....::||..:|..|.|..  :|:|..|||.|:..:|....
  Fly    80 NLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPILFYGNKMDMEDSLSSVK 144

  Fly   143 LIERMNLSSIQDR--EICCYSISCKEKDNIDITLQWLIQH-----------SKSQSR 186
            :...:.|.:|:|:  .||  |.|....:.:...:|||||.           :||:|:
  Fly   145 IAAALRLENIKDKPWHIC--SSSAISGEGLGEGVQWLIQQMRFAMLNNKNAAKSRSK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 49/164 (30%)
Arl6NP_611421.1 Arl6 19..182 CDD:206722 49/164 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.