DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and CG13692

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_608523.1 Gene:CG13692 / 33216 FlyBaseID:FBgn0031254 Length:193 Species:Drosophila melanogaster


Alignment Length:132 Identity:30/132 - (22%)
Similarity:60/132 - (45%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSL 114
            ||..|.|:.|      :|::.:|||.  ...:|.:|...|..::|:||.::|.::.|:....:|:
  Fly    67 IPHGGKNLPK------SIQILEIGGS--MAPLWRQYFEDVKKLIYVVDTSNLCQISAAGVLFYSI 123

  Fly   115 LDKPQLA-GIPVLVLGNKRDLPGALDETGLIERMNLSSIQD---REICCYSISCKEKDNIDITLQ 175
            |.:|:|. ...:|::..|.|..........:..:.:..:|.   :::.....|...|..:|....
  Fly   124 LTEPRLQHNTKILLVLAKMDYSYRQMRNEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYD 188

  Fly   176 WL 177
            ||
  Fly   189 WL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 30/132 (23%)
CG13692NP_608523.1 P-loop_NTPase 4..191 CDD:304359 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.