DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and Arfrp1

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_572526.1 Gene:Arfrp1 / 31841 FlyBaseID:FBgn0030088 Length:200 Species:Drosophila melanogaster


Alignment Length:184 Identity:48/184 - (26%)
Similarity:97/184 - (52%) Gaps:15/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WFKSIFWKEEMELTLVGLQFSGKTTFVNVIAS-------GQFAEDMIPTVGFNMRKITRGNVTIK 68
            ::|.:..|::..:.::||..:||||::....:       |.....:..|||.|:..|....|.:.
  Fly     8 FYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLN 72

  Fly    69 VWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRD 133
            .||:|||...:|:|::|.:..:.::|::|:.|.:::|.|:.....::....|:|:|:|:|.||:|
  Fly    73 FWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQD 137

  Fly   134 LPGALDETGLIE-----RMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSK 182
            ||   |..|:.|     :...:.|..|:.....:|....:.:|..::||::..|
  Fly   138 LP---DVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 45/169 (27%)
Arfrp1NP_572526.1 small_GTP 17..181 CDD:272973 43/166 (26%)
Arfrp1 19..186 CDD:206725 45/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.