DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and ARL13B

DIOPT Version :10

Sequence 1:NP_649769.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_878899.1 Gene:ARL13B / 200894 HGNCID:25419 Length:428 Species:Homo sapiens


Alignment Length:190 Identity:61/190 - (32%)
Similarity:106/190 - (55%) Gaps:15/190 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKE---EMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITR 62
            |.:|:.....|||.  |:|   ::.|.:|||..:|||.....| .|::.||:.|||||:...:.:
Human     1 MFSLMASCCGWFKR--WREPVRKVTLLMVGLDNAGKTATAKGI-QGEYPEDVAPTVGFSKINLRQ 62

  Fly    63 GNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLV 127
            |...:.::|:||..|.|.:|:.|......::::||::|.:::|.::..:..:|..|:::|.|:||
Human    63 GKFEVTIFDLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILV 127

  Fly   128 LGNKRDLPGALDETGLIERMNLSSIQDREIC------CYSIS---CKEKDNIDITLQWLI 178
            |.||:|..|||.|..:||.::|..:.:...|      |.:||   .|...:|...|.||:
Human   128 LANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWLL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_649769.1 Arl10_like 22..180 CDD:206724 54/166 (33%)
ARL13BNP_878899.1 Arl2l1_Arl13_like 23..189 CDD:133361 54/166 (33%)
CCDC47 <199..241 CDD:480722
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..287
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..428
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.