DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and arl-8

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_502791.1 Gene:arl-8 / 178405 WormBaseID:WBGene00000192 Length:185 Species:Caenorhabditis elegans


Alignment Length:184 Identity:158/184 - (85%)
Similarity:173/184 - (94%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNV 65
            |||::|::|:|.:|:||||||||||||||.|||||||||||||||.|||||||||||||||:|||
 Worm     1 MLAMVNKVLDWIRSLFWKEEMELTLVGLQNSGKTTFVNVIASGQFTEDMIPTVGFNMRKITKGNV 65

  Fly    66 TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGN 130
            |||:||||||||||||||||||||||||:||||||.:|||||||||..|||||||..||||||||
 Worm    66 TIKLWDIGGQPRFRSMWERYCRGVNAIVFMVDAADEEKLEASRNELMQLLDKPQLDAIPVLVLGN 130

  Fly   131 KRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184
            |:||||||||..|||||||||||:|||||||||||||:||||||||||.|||:|
 Worm   131 KKDLPGALDERQLIERMNLSSIQNREICCYSISCKEKENIDITLQWLIDHSKAQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 141/157 (90%)
arl-8NP_502791.1 Arl10_like 22..180 CDD:206724 141/157 (90%)
Ras 23..178 CDD:278499 138/154 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 303 1.000 Domainoid score I757
eggNOG 1 0.900 - - E2759_KOG0075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 329 1.000 Inparanoid score I1444
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 1 1.000 - - oto19497
orthoMCL 1 0.900 - - OOG6_101541
Panther 1 1.100 - - LDO PTHR45732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3186
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.