DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and Arl14

DIOPT Version :10

Sequence 1:NP_649769.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001386692.1 Gene:Arl14 / 103690167 RGDID:9465124 Length:192 Species:Rattus norvegicus


Alignment Length:152 Identity:56/152 - (36%)
Similarity:89/152 - (58%) Gaps:16/152 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EEMELTLVGLQFSGKTTFVNVIASGQFAEDM--IPTVGFNMRKI-TRGNVTIKVWDIGGQPRFRS 80
            ::..:.|:||..:||:|.:..:   :|||.:  |||:|||:..: .:..:.:.|||||||.:.|:
  Rat    12 KQAHILLLGLDSAGKSTLLYRL---KFAETLATIPTIGFNVEMVQLQSGLALTVWDIGGQEKMRT 73

  Fly    81 MWERYCRGVNAIVYMVDAADLDK-LEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGAL---DET 141
            :|:.||...:.:||:||.::..| ||.||.|...:|....:...||::|.||:||||||   |.|
  Rat    74 VWDCYCENAHGLVYVVDCSEGQKRLEDSRKEFKHILKNEHIKNTPVVILANKQDLPGALSAEDIT 138

  Fly   142 GLIERMNLSSIQDR----EICC 159
            .:.:...|.|  ||    :.||
  Rat   139 RMFKVKKLCS--DRNWYVQPCC 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_649769.1 Arl10_like 22..180 CDD:206724 56/149 (38%)
Arl14NP_001386692.1 ARLTS1 15..175 CDD:133356 56/149 (38%)

Return to query results.
Submit another query.