DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and arl8b

DIOPT Version :9

Sequence 1:NP_001287225.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001190182.1 Gene:arl8b / 100492504 XenbaseID:XB-GENE-490246 Length:186 Species:Xenopus tropicalis


Alignment Length:184 Identity:160/184 - (86%)
Similarity:176/184 - (95%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNV 65
            ||:|::|:|:||:|:||||||||||||||.|||||||||||||||:|||||||||||||:|:|||
 Frog     1 MLSLLSRLLDWFRSLFWKEEMELTLVGLQHSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNV 65

  Fly    66 TIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGN 130
            |||:|||||||||||||||||||||||||||||||.:|:||||||||:|||||||.|||||||||
 Frog    66 TIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKIEASRNELHNLLDKPQLQGIPVLVLGN 130

  Fly   131 KRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184
            ||||..||||..|||:||||.||||||||||||||||||||||||||||||||:
 Frog   131 KRDLHTALDEKQLIEKMNLSLIQDREICCYSISCKEKDNIDITLQWLIQHSKSR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_001287225.1 Arl10_like 22..180 CDD:206724 141/157 (90%)
arl8bNP_001190182.1 Arl10_like 22..180 CDD:206724 141/157 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 312 1.000 Domainoid score I1293
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 340 1.000 Inparanoid score I2309
OMA 1 1.010 - - QHG53833
OrthoDB 1 1.010 - - D1123043at2759
OrthoFinder 1 1.000 - - FOG0001860
OrthoInspector 1 1.000 - - otm49391
Panther 1 1.100 - - O PTHR45732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3186
SonicParanoid 1 1.000 - - X1060
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.