DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arl8 and si:ch1073-165f9.2

DIOPT Version :10

Sequence 1:NP_649769.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002663882.2 Gene:si:ch1073-165f9.2 / 100333040 ZFINID:ZDB-GENE-141216-228 Length:181 Species:Danio rerio


Alignment Length:175 Identity:56/175 - (32%)
Similarity:94/175 - (53%) Gaps:3/175 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQ 75
            |.: :|.|::..|.:.||..:||||.:..:..|:.. ..|||:|||:..:...|::..|||..||
Zfish     9 WTR-LFEKKQTRLLMFGLDAAGKTTVLYKLKLGEVV-TTIPTIGFNVETVEYKNISFTVWDFSGQ 71

  Fly    76 PRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDE 140
            ...:|:|..|......::::||::|.|::|.:..||:.||.:.:|....:|||.||:|||.|:..
Zfish    72 TTMKSLWRHYYSNTQGLIFVVDSSDRDRIETAAEELNLLLAEDELRDAVLLVLANKQDLPKAMLA 136

  Fly   141 TGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLI-QHSKSQ 184
            ..|.:|:.|.::..|:....|....:...:.....||. |.||.|
Zfish   137 QELTDRLGLHALTGRQWFVQSTCAVQGSGLYEGFDWLTDQLSKQQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arl8NP_649769.1 Arl10_like 22..180 CDD:206724 49/158 (31%)
si:ch1073-165f9.2XP_002663882.2 None

Return to query results.
Submit another query.