DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7878 and DBP3

DIOPT Version :9

Sequence 1:NP_649767.1 Gene:CG7878 / 40959 FlyBaseID:FBgn0037549 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_011437.3 Gene:DBP3 / 852802 SGDID:S000003046 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:458 Identity:175/458 - (38%)
Similarity:269/458 - (58%) Gaps:29/458 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LTKNFYKEAPEVANLTKSEIERIREENNKITVSYVFEPKEGETSPPIP-NPVWTFEQCFAEYPDM 294
            :...||.::..:.:|.:|:|:...:| |:|.|         |.|..:. .|:.:|:....: ..:
Yeast    72 VASEFYVQSEALTSLPQSDIDEYFKE-NEIAV---------EDSLDLALRPLLSFDYLSLD-SSI 125

  Fly   295 LEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQSTPRGTRGGAN 359
            ..||:|  |.||:|||:.|||.||.|.|::|:|:||:|||.||.:|.:.|.......||.:    
Yeast   126 QAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQ---- 184

  Fly   360 VLVLAPTRELALQIEMEVKKYSFR-GMKAVCVYGGGNRNMQISDLERGAEIIICTPGRLNDLIMA 423
            |||::||||||.||...:...:.: ||:..|||||..::.|...|:: :::::.|||||.||:..
Yeast   185 VLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKK-SQVVVATPGRLLDLLQE 248

  Fly   424 NVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDI-RPDRQTIMTSATWPPGVRRLAQSYMKNPI 487
            ..:|:|.:.|||||||||||:.|||..|:.::.:. ...|||:|.:||||..||.||.::|.|||
Yeast   249 GSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPI 313

  Fly   488 QVCVGSLD-LAATHSVKQIIKLMEDDMDKFNTITSFVKNMSS----TDKIIIFCGRKVRADDLSS 547
            :|.:|:.| |.|...:.||:::: |...|...:...:|...|    .:|::||...|..|..:..
Yeast   314 KVSIGNTDQLTANKRITQIVEVV-DPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVER 377

  Fly   548 ELTLDGFMTQCIHGNRDQMDREQAIADIKSGVVRILVATDVASRGLDIEDITHVINYDFPHNIEE 612
            .|..:|:....|||:..|..|.||:.:.|||...:|:|||||:|||||.::..|||..||..:|:
Yeast   378 NLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVED 442

  Fly   613 YVHRVGRTGRAGRQGTSISFFTREDWAMAKELIEILQEAEQEVPDELHNMARRFKAMKDKRAAEG 677
            ||||:|||||||:.||:.:.||.::..:|..|:.:|..|.|.||::|.......|  |.:.:|.|
Yeast   443 YVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVPEDLIKFGTHTK--KKEHSAYG 505

  Fly   678 GGF 680
            ..|
Yeast   506 SFF 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7878NP_649767.1 KH-I 92..150 CDD:238053
DEADc 288..489 CDD:238167 89/202 (44%)
DEXDc 298..505 CDD:214692 93/209 (44%)
Helicase_C 514..624 CDD:278689 46/113 (41%)
DBP3NP_011437.3 SrmB 88..519 CDD:223587 172/442 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.