DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7878 and Ddx23

DIOPT Version :10

Sequence 1:NP_649767.1 Gene:CG7878 / 40959 FlyBaseID:FBgn0037549 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_001074450.1 Gene:Ddx23 / 74351 MGIID:1921601 Length:819 Species:Mus musculus


Alignment Length:119 Identity:30/119 - (25%)
Similarity:49/119 - (41%) Gaps:30/119 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KDLQRPA---VIKEDL---SEMERRKRVQQIL------------------ESKSFCHELEEVIRQ 64
            :|||...   |:||:.   :|||.:|. |:|.                  :|||.|:...:..|:
Mouse    22 EDLQEQTDLMVLKEETHQWNEMEEKKH-QEITTDEKPTLTKKTSSRGRPRKSKSGCNFSCKRCRK 85

  Fly    65 ECDTARTDPD-HLQVLQKLSDLTVPQGNMSFGNLHTYGGNTIAIADLRGNEKYS 117
            .. :.|::.| |::|.......|..|...||   :|.|..|:.:....|...|:
Mouse    86 SF-SQRSNLDVHMRVHTGEKPYTCKQCGKSF---YTIGNLTVHMRIHTGERPYA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7878NP_649767.1 KH_1 92..152 CDD:459630 7/26 (27%)
DEAD-like_helicase_N 174..663 CDD:475120
Ddx23NP_001074450.1 SF-CC1 79..>207 CDD:273721 14/61 (23%)
SrmB 391..782 CDD:440279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.