DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7878 and Dbp45A

DIOPT Version :9

Sequence 1:NP_649767.1 Gene:CG7878 / 40959 FlyBaseID:FBgn0037549 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_476927.1 Gene:Dbp45A / 35917 FlyBaseID:FBgn0010220 Length:521 Species:Drosophila melanogaster


Alignment Length:420 Identity:131/420 - (31%)
Similarity:198/420 - (47%) Gaps:60/420 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 PDMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQSTPRGTRG 356
            |.:::::||:|....:|||.:..|.:|.|.|.||.|:||:|||.||.||.:.....:....    
  Fly    16 PWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSH---- 76

  Fly   357 GANVLVLAPTRELALQI-EMEVKKYSFRGMKAVCVYGGGNRNMQISDLERGAEIIICTPGRLND- 419
              ..|||.||.|||.|| |..:......|::...|.||.::.::...|.:...|::..||||.| 
  Fly    77 --FALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQKLMQRPHIVVAMPGRLADH 139

  Fly   420 LIMANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDRQTIMTSATWPPGVRRLAQSYMK 484
            |...:......:.|||:|||||||:..|:..:..:...:...||.:..|||        .:.::|
  Fly   140 LTGCDTFSFDNLKYLVVDEADRMLNGDFDESLSIIERCLPKTRQNLFFSAT--------MKDFIK 196

  Fly   485 NPIQVCVGS--------LDLAATHSVKQIIKLMED---DMDKFNTITSFVKNMSSTDKIIIFCGR 538
            ......:.|        .|:|...::.|...|..|   ||.....:..: :..:....::||...
  Fly   197 ESSIFPIASDCFEWSQDSDVATVETLDQRYLLCADYDRDMVLIEALRKY-REENENANVMIFTNT 260

  Fly   539 KVRADDLSSELTLDGFMTQCIHGNRDQMDREQAIADIKSGVVRILVATDVASRGLDIEDITHVIN 603
            |.....||..|........|:||...|.:|..|::..||..:|.|:|||||:|||||..:..|:|
  Fly   261 KKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIATDVAARGLDIPSVELVMN 325

  Fly   604 YDFPHNIEEYVHRVGRTGRAGRQGTSISF--FTREDWAMAKELIEILQEAEQEVPDEL--H---- 660
            :..|...:||:||||||.||||:|.|||.  |.|:        :|:|...|:|:..:|  |    
  Fly   326 HMLPRTPKEYIHRVGRTARAGRKGMSISIFRFPRD--------LELLAAIEEEINTKLTEHPIDQ 382

  Fly   661 ----------NMARRFKAMK------DKRA 674
                      |:.||...|:      |:||
  Fly   383 RMVERIFMQVNVTRRESEMQLDNNDFDERA 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7878NP_649767.1 KH-I 92..150 CDD:238053
DEADc 288..489 CDD:238167 63/198 (32%)
DEXDc 298..505 CDD:214692 65/216 (30%)
Helicase_C 514..624 CDD:278689 38/109 (35%)
Dbp45ANP_476927.1 SrmB 8..490 CDD:223587 131/420 (31%)
DEADc 9..197 CDD:238167 62/194 (32%)
Helicase_C 239..346 CDD:278689 38/107 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.