DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7878 and Ddx5

DIOPT Version :9

Sequence 1:NP_649767.1 Gene:CG7878 / 40959 FlyBaseID:FBgn0037549 Length:703 Species:Drosophila melanogaster
Sequence 2:NP_001007614.1 Gene:Ddx5 / 287765 RGDID:619906 Length:615 Species:Rattus norvegicus


Alignment Length:560 Identity:216/560 - (38%)
Similarity:325/560 - (58%) Gaps:70/560 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 DRGQDRDNRDHGSNERYDGGGYDRYKGNSYEFNPTSSESNKDNGDLTGIIDWEALNKASIAATAA 223
            |||:||            |.|..|:                 .|..||.:..:............
  Rat     9 DRGRDR------------GFGAPRF-----------------GGSRTGPLSGKKFGNPGEKLVKK 44

  Fly   224 RWS--KCPPLTKNFYKEAPEVANLTKSEIERIREENNKITVSYVFEPKEGETSPPIPNPVWTFEQ 286
            :|:  :.|...||||:|.|::|..|..|::..| .:.:|||       .|..   .|.||..|.:
  Rat    45 KWNLDELPKFEKNFYQEHPDLARRTAQEVDTYR-RSKEITV-------RGHN---CPKPVLNFYE 98

  Fly   287 CFAEYP-DMLEEITKMGFSKPSPIQSQAWPILLQGHDMIGIAQTGTGKTLAFLLPGMIHTEYQST 350
              |.:| ::::.|.:..|::|:.||:|.||:.|.|.||:|:||||:||||::|||.::|..:|  
  Rat    99 --ANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQ-- 159

  Fly   351 PRGTRG-GANVLVLAPTRELALQIEMEVKKY--SFRGMKAVCVYGGGNRNMQISDLERGAEIIIC 412
            |...|| |...||||||||||.|::....:|  :.| :|:.|:|||..:..||.|||||.||.|.
  Rat   160 PFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACR-LKSTCIYGGAPKGPQIRDLERGVEICIA 223

  Fly   413 TPGRLNDLIMANVIDVSTITYLVLDEADRMLDMGFEPQIRKVMLDIRPDRQTIMTSATWPPGVRR 477
            |||||.|.:.....::...||||||||||||||||||||||::..|||||||:|.|||||..||:
  Rat   224 TPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQ 288

  Fly   478 LAQSYMKNPIQVCVGSLDLAATHSVKQIIKLMEDDMDKFNTITSFVKNMSS--TDKIIIFCGRKV 540
            ||:.::|:.|.:.:|:|:|:|.|::.||:.:.. |::|...:...::.:.|  .:|.|:|...|.
  Rat   289 LAEDFLKDYIHINIGALELSANHNILQIVDVCH-DVEKDEKLIRLMEEIMSEKENKTIVFVETKR 352

  Fly   541 RADDLSSELTLDGFMTQCIHGNRDQMDREQAIADIKSGVVRILVATDVASRGLDIEDITHVINYD 605
            |.|:|:.::..||:....|||::.|.:|:..:.:.|.|...||:||||||||||:||:..|||||
  Rat   353 RCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYD 417

  Fly   606 FPHNIEEYVHRVGRTGRAGRQGTSISFFTREDWAMAKELIEILQEAEQEVPDELHNMARRFKAMK 670
            :|::.|:|:||:|||.|:.:.||:.:|||..:.....:||.:|:||.|.:..:|      .:.::
  Rat   418 YPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKL------LQLVE 476

  Fly   671 DKRAAEGGGFGG----RGGRFGGGRGGG------RRNFDQ 700
            |:.:....|.||    |..|:..|:.||      |.|:|:
  Rat   477 DRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7878NP_649767.1 KH-I 92..150 CDD:238053
DEADc 288..489 CDD:238167 107/204 (52%)
DEXDc 298..505 CDD:214692 110/209 (53%)
Helicase_C 514..624 CDD:278689 46/111 (41%)
Ddx5NP_001007614.1 PTZ00110 6..507 CDD:240273 213/549 (39%)
P68HR 498..532 CDD:400414 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000439
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.