DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and YVH1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_012292.3 Gene:YVH1 / 854844 SGDID:S000001465 Length:364 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:74/304 - (24%)
Similarity:107/304 - (35%) Gaps:97/304 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LLLGNGRDADDPSSVGANCVLNVTCQSPNESHL---------------QGLKYMQIPASDTPHQN 190
            :.||..|...|...:||.  .|:|       |:               :|.....||..|....:
Yeast    19 IYLGGIRPIIDHRPLGAE--FNIT-------HILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTD 74

  Fly   191 IKQYFQEAYDFIE---------------DARKTGSR--VLLHCHAGISRSATIAIAYVMRYKSLS 238
            :.|||.|...||:               |.:|...|  |..||.||:|||.|..:||:|....||
Yeast    75 VLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLS 139

  Fly   239 LLEAYKLVKVARPIISPNLNFMGQLLELEQ----------------NLRKSGVLAPATPHLNSPS 287
            |..|...||..:|.:.||.|||.||...|:                .|::|..|.|:...|    
Yeast   140 LSMAMHAVKRKKPSVEPNENFMEQLHLFEKMGGDFVDFDNPAYKQWKLKQSIKLDPSGSEL---- 200

  Fly   288 NPSSSSVGLSTQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAGSNCSS 352
             .|:|.:...::|||.:::..|.||                           |...::....|.:
Yeast   201 -VSNSGMFKDSESSQDLDKLTEAEK---------------------------SKVTAVRCKKCRT 237

  Fly   353 RLT--------SPPITPDDEAPSTSAAASSVSELDSPSSTSSSS 388
            :|.        .||.....|......||:|...:|...|.::.|
Yeast   238 KLALSTSFIAHDPPSKESSEGHFIKRAANSHRIIDIQESQANCS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 48/157 (31%)
CDC14 <193..272 CDD:225297 37/111 (33%)
YVH1NP_012292.3 DSP_fungal_YVH1 12..173 CDD:350368 49/162 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.