DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and SDP1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_012153.1 Gene:SDP1 / 854693 SGDID:S000001375 Length:209 Species:Saccharomyces cerevisiae


Alignment Length:125 Identity:44/125 - (35%)
Similarity:66/125 - (52%) Gaps:14/125 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYD------FIEDARKTGSRVLLHCHA 218
            |:|| .:..|:..      ||:||.:..|...:...|.|.|      .|..|.....::|:||..
Yeast    85 VINV-AEEANDLR------MQVPAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQC 142

  Fly   219 GISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLR-KSGVLA 277
            |:|||||:.|||:|:|.:|||..:|.|:|.....|:|::..:.||:|.|..|. |:.|.|
Yeast   143 GLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAKTNVQA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 39/112 (35%)
CDC14 <193..272 CDD:225297 32/85 (38%)
SDP1NP_012153.1 DSP_fungal_SDP1-like 56..194 CDD:350371 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343504
Domainoid 1 1.000 69 1.000 Domainoid score I2289
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10159
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.