DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and PHS1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_851066.2 Gene:PHS1 / 832437 AraportID:AT5G23720 Length:929 Species:Arabidopsis thaliana


Alignment Length:394 Identity:98/394 - (24%)
Similarity:152/394 - (38%) Gaps:95/394 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SNNNSNNTTT--ATSTARNNNSHNGRCECDGD---------------GDSVSHIQSEMKMRIKRE 58
            |:|:|:::.:  ..|..|..||.|..   ||.               |:|:|..:...|:|...:
plant   569 SDNSSDHSESDMQKSVPRTPNSENKE---DGSSPKSRESWHGRSGKGGESLSSQRLAAKLRDFHK 630

  Fly    59 APCLLLFMPIQNTNNNNRIGANQKDYPNKRSRENL--ACDEVTSTTSSSTAMNGGGRTPALTRSC 121
                  |..:...:|      .:.|..|:..|..:  .|.|        ...|.|....:...||
plant   631 ------FAKVDAESN------KELDQWNETLRNEVMKLCQE--------NGFNTGFFEGSDNNSC 675

  Fly   122 SSPAVYDIE------------------THPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQSP 168
            :.  .|:::                  |...|.:..:|.:|.|..|....::....:.:|.|...
plant   676 TD--AYELKVRLEHILERISLISKAANTEKPSMIQENLFIGGGLAARSIYTLQHLGITHVLCLCA 738

  Fly   169 NE------SHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIA 227
            ||      .:....:|.....:|....||:..||||.|||:...:||.::|:||..|.|||||:.
plant   739 NEIGQSDTQYPDLFEYQNFSITDDEDSNIESIFQEALDFIKHGEETGGKILVHCFEGRSRSATVV 803

  Fly   228 IAYVMRYKSLSLLEAY-KLVKVARPIISPNLNFMGQLLELEQNL--------RKSGVLAPATPHL 283
            :||:|..|.|:||||: ||.||.|. ..||..|...|:.|::..        |:........|..
plant   804 LAYLMLQKKLTLLEAWSKLRKVHRR-AQPNDGFARILINLDKKCHGKVSMEWRQRKPTMKVCPVC 867

  Fly   284 NSPSNPSSSSVGLSTQSSQLVEQPEEEEKREQRERGKSKSDSEAMD---EDGFDYDDVDSGSGSL 345
            ...:..||||:.|..|.|             .|:......|| ||:   :...:...:.:|.||.
plant   868 GKNAGLSSSSLKLHLQKS-------------HRKLSSGSVDS-AMNMEIQKALEALKLSTGRGSS 918

  Fly   346 AGSN 349
            |.||
plant   919 ASSN 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 49/140 (35%)
CDC14 <193..272 CDD:225297 37/87 (43%)
PHS1NP_851066.2 Act-Frag_cataly 111..426 CDD:370352
DSP 704..841 CDD:350348 49/137 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.