DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and DSPTP1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001189955.1 Gene:DSPTP1 / 821941 AraportID:AT3G23610 Length:228 Species:Arabidopsis thaliana


Alignment Length:183 Identity:58/183 - (31%)
Similarity:93/183 - (50%) Gaps:13/183 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 STTSSSTAMNG--------GGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPS--- 153
            |::|||:::.|        ..:..||.|.......|..:..| |.:...|.||:...|.:.:   
plant    10 SSSSSSSSLPGIEKYNEKVKNQIQALVRVIKVARTYRDDNVP-SLIEQGLYLGSVAAASNKNVLK 73

  Fly   154 SVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHA 218
            |.....:|.| ..|...:|.....|..:...|....|::.||.|..|||::|::.|..||:||..
plant    74 SYNVTHILTV-ASSLRPAHPDDFVYKVVRVVDKEDTNLEMYFDECVDFIDEAKRQGGSVLVHCFV 137

  Fly   219 GISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLR 271
            |.|||.||.:||:|:...::|.:|.:.||..||:.|||..|:.||.:||::::
plant   138 GKSRSVTIVVAYLMKKHGMTLAQALQHVKSKRPVASPNAGFIRQLQDLEKSMQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 47/136 (35%)
CDC14 <193..272 CDD:225297 35/79 (44%)
DSPTP1NP_001189955.1 DSPc 51..186 CDD:238073 47/136 (35%)
CDC14 53..191 CDD:225297 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10159
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.