DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and MKP2

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001189821.1 Gene:MKP2 / 819784 AraportID:AT3G06110 Length:167 Species:Arabidopsis thaliana


Alignment Length:150 Identity:41/150 - (27%)
Similarity:68/150 - (45%) Gaps:23/150 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LLGNGRDADDPSSVGANCVLNVTCQSPNESHLQG--------------------LKYMQIPASDT 186
            ||..|:|.   |.:.....:....::.|:..|:.                    ..|..|...|.
plant    18 LLEGGKDL---SEIQQGLFIGSVAEANNKDFLKSSNITHVLTVAVALAPPYPDDFVYKVIEVVDR 79

  Fly   187 PHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARP 251
            ...::..||.|.|.||:.|.::|..||:||..|:|||.||.:||:|:...:...:|.:||:..|.
plant    80 SETDLTVYFDECYSFIDQAIQSGGGVLVHCFMGMSRSVTIVVAYLMKKHGMGFSKAMELVRSRRH 144

  Fly   252 IISPNLNFMGQLLELEQNLR 271
            ...||..|:.||.:.|::::
plant   145 QAYPNPGFISQLQQFEKSIQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 40/144 (28%)
CDC14 <193..272 CDD:225297 31/78 (40%)
MKP2NP_001189821.1 DSP 26..158 CDD:350348 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10159
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.