DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and AT2G35680

DIOPT Version :10

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_565816.1 Gene:AT2G35680 / 818137 AraportID:AT2G35680 Length:337 Species:Arabidopsis thaliana


Alignment Length:55 Identity:20/55 - (36%)
Similarity:31/55 - (56%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 EAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARP 251
            :|.:||......|....:||.||..||.||.|.|::::|:::...||..|:..||
plant   145 QAVEFIHRNASLGKTTYVHCKAGRGRSTTIVICYLVQHKNMTPEAAYSYVRSIRP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 PTP_DSP_cys 135..281 CDD:475123 20/55 (36%)
AT2G35680NP_565816.1 PTPMT1 73..215 CDD:350374 20/55 (36%)

Return to query results.
Submit another query.