DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and IBR5

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_178534.2 Gene:IBR5 / 814997 AraportID:AT2G04550 Length:257 Species:Arabidopsis thaliana


Alignment Length:251 Identity:65/251 - (25%)
Similarity:98/251 - (39%) Gaps:67/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KRSRENLACD-----------EVTSTTSSSTAMNGGGRTPALTRSCSSPAVYDIETHPASPVFPH 140
            ||.||| .|.           ||....         |....::....:|....:...| |.:.|.
plant     3 KREREN-PCSICGHYHKYEEGEVCGVC---------GHCMPVSSDTVAPQQVHVSAFP-SEILPE 56

  Fly   141 LL-LG---NGRDADDPSSVGANCVLNVT--CQS--PNESHLQGLKYMQIPASDTPHQNIKQYFQE 197
            .| ||   |...::...:.|.:.|||..  ||:  .|.....||          .::.:.| |.:
plant    57 FLYLGSYDNASRSELLKTQGISRVLNTVPMCQNLYRNSFTYHGL----------DNEKVLQ-FDD 110

  Fly   198 AYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQ 262
            |..|::...|..:|||:||.:|.|||..:.:||:|:.|...|.|:::.||..||....:..|..|
plant   111 AIKFLDQCEKDKARVLVHCMSGKSRSPAVVVAYLMKRKGWRLAESHQWVKQRRPSTDISPEFYQQ 175

  Fly   263 LLELEQNLRKSGVL---------------------APATPHLNSP-----SNPSSS 292
            |.|.||.:..|.::                     |.|....|:|     |:|:||
plant   176 LQEFEQGIFGSEMMSAMNINDAPTFGFGFPKIDNQAQAPVFNNAPTSSIFSSPASS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 44/141 (31%)
CDC14 <193..272 CDD:225297 30/78 (38%)
IBR5NP_178534.2 DSPc 50..180 CDD:238073 44/141 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.