DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp18

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_776106.1 Gene:Dusp18 / 75219 MGIID:1922469 Length:188 Species:Mus musculus


Alignment Length:139 Identity:48/139 - (34%)
Similarity:76/139 - (54%) Gaps:4/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SPVFPHLLLGNGRDADDPSSVGAN---CVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQ 196
            |.:...|.:.||..|::...:.:|   .|:||:.:..| :..:.::|:|:|..|.|...:..:|.
Mouse    21 SQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVAN-TFYEDIQYVQVPVVDAPVARLSNFFD 84

  Fly   197 EAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMG 261
            ...|.|........|.||||.||:||||.:.:||:|:|.::||::|:...|..||||.||..|..
Mouse    85 SVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPNSGFWE 149

  Fly   262 QLLELEQNL 270
            ||:..|..|
Mouse   150 QLIHYELQL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 46/134 (34%)
CDC14 <193..272 CDD:225297 33/78 (42%)
Dusp18NP_776106.1 PTP_DSP_cys 19..176 CDD:391942 48/139 (35%)
Sufficient for mitochondrial localization 95..141 21/45 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.