DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and zgc:153044

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001038858.1 Gene:zgc:153044 / 751678 ZFINID:ZDB-GENE-060825-247 Length:182 Species:Danio rerio


Alignment Length:138 Identity:52/138 - (37%)
Similarity:83/138 - (60%) Gaps:4/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VFPHLLLGNGRDADDP---SSVGANCVLNVTCQS-PNESHLQGLKYMQIPASDTPHQNIKQYFQE 197
            |..||.:|..:.|.|.   .|:...|::|.|..: .:::||....|||||..|.|...:.:||..
Zfish    15 VTDHLFIGTSKTASDSRILQSLHITCIINSTQNTHSSDTHLPSAHYMQIPVPDDPSCRLSEYFHS 79

  Fly   198 AYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQ 262
            ..|.|:...:...||||||:||:||||::.:|:::::..|:|.||::::|..||||.||..|..|
Zfish    80 VSDKIQQVSEERGRVLLHCNAGVSRSASLCLAFLIKHHRLTLREAHQMLKAKRPIIRPNNGFWSQ 144

  Fly   263 LLELEQNL 270
            |:|.|.::
Zfish   145 LVEFELSI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 51/133 (38%)
CDC14 <193..272 CDD:225297 33/78 (42%)
zgc:153044NP_001038858.1 DSPc 14..149 CDD:238073 51/133 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.