DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp6

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001039043.2 Gene:dusp6 / 733815 XenbaseID:XB-GENE-978216 Length:378 Species:Xenopus tropicalis


Alignment Length:194 Identity:81/194 - (41%)
Similarity:107/194 - (55%) Gaps:21/194 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 STTSSSTAMNGGGRTP-ALTRSCSSPAVYDIETHPASPV--FPHLLLGNGRDA---DDPSSVGAN 158
            |:.|||...:...|.| :.|.|..||.   ..|.|:.||  .|:|.||..:|:   |.....|..
 Frog   170 SSDSSSDIESDIDRDPNSATDSDGSPL---SNTQPSFPVEILPYLYLGCAKDSTNLDVLEEFGIK 231

  Fly   159 CVLNVTCQSPNESHLQG-LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISR 222
            .:||||...||.....| .:|.|||.||...||:.|:|.||..||::||.....||:||.|||||
 Frog   232 YILNVTPNLPNLFENAGEFRYKQIPISDHWSQNLSQFFPEAISFIDEARGKSCGVLVHCLAGISR 296

  Fly   223 SATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSP 286
            |.|:.:||:|:..:||:.:||.:||:.:..||||.|||||||:.|:.|           .||||
 Frog   297 SVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL-----------GLNSP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 64/139 (46%)
CDC14 <193..272 CDD:225297 41/78 (53%)
dusp6NP_001039043.2 DSP_MapKP 17..146 CDD:238723
DSP_MKP_classII 204..340 CDD:350414 63/135 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.