DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp3

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006534368.1 Gene:Dusp3 / 72349 MGIID:1919599 Length:236 Species:Mus musculus


Alignment Length:206 Identity:63/206 - (30%)
Similarity:95/206 - (46%) Gaps:34/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YDIETHPASPVFPHLLLGNGRDADDPS---SVGANCVLNVTCQSPNESHL---------QGLKYM 179
            |.:.:.|.:.|.|.:.:||...|.|.:   .:|...||| ..:..:..|:         .|:.|:
Mouse    48 YSLPSQPCNEVVPRVYVGNASVAQDITQLQKLGITHVLN-AAEGRSFMHVNTSASFYEDSGITYL 111

  Fly   180 QIPASDTPHQNIKQYFQEAYDFIED--ARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEA 242
            .|.|:||...|:..||:.|.|||:.  |.|.| |||:||..|.|||.|:.|||:|..:.:.:..|
Mouse   112 GIKANDTQEFNLSAYFERATDFIDQALAHKNG-RVLVHCREGYSRSPTLVIAYLMMRQKMDVKSA 175

  Fly   243 YKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSSSSVGLSTQSSQLVEQP 307
            ...|:..|. |.||..|:.||.:|...|.|.|            .:|.:.|:..:.     ..:.
Mouse   176 LSTVRQNRE-IGPNDGFLAQLCQLNDRLAKEG------------KDPETDSLDRNE-----TWRH 222

  Fly   308 EEEEKREQRER 318
            .|..:||.:||
Mouse   223 HENGERESKER 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 51/147 (35%)
CDC14 <193..272 CDD:225297 34/80 (43%)
Dusp3XP_006534368.1 DUSP3 35..202 CDD:350427 53/156 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.