DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp28

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_003750786.3 Gene:Dusp28 / 684024 RGDID:1595220 Length:163 Species:Rattus norvegicus


Alignment Length:160 Identity:51/160 - (31%)
Similarity:81/160 - (50%) Gaps:10/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PASPVFPHLLLGNGRDADDPS---SVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQY 194
            |.:.|.|.|.:||.|.|....   ..|....:||:.|.|. ....|:..:::|..|.|.:::..:
  Rat    10 PFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPG-PRAPGVAELRVPVFDDPAEDLLTH 73

  Fly   195 FQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNF 259
            .:.....:|.|.:.|...|::|..|.||||.:..||:||::..||..|:::||.|||:..|||.|
  Rat    74 LEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDCAFQMVKSARPVAEPNLGF 138

  Fly   260 MGQLLELEQNLRKSGVLAPATPHLNSPSNP 289
            ..||.:.||.|:...:|.      ..|::|
  Rat   139 WAQLQKYEQTLQAQAILP------QEPTDP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 45/136 (33%)
CDC14 <193..272 CDD:225297 31/78 (40%)
Dusp28XP_003750786.3 DUSP28 11..150 CDD:350422 46/139 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.