DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and STYX

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001124173.1 Gene:STYX / 6815 HGNCID:11447 Length:223 Species:Homo sapiens


Alignment Length:159 Identity:52/159 - (32%)
Similarity:81/159 - (50%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHA 218
            ::.||.:      .||...|  .:|:.:..:|.|.:||.::|....:||:.:.:.|.:||:|.:|
Human    66 NIEANFI------KPNFQQL--FRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNA 122

  Fly   219 GISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHL 283
            ||||||...|||:|....:...:|:..|:..|..|:||..|:.||.|.|     :..||..|..:
Human   123 GISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYE-----AIYLAKLTIQM 182

  Fly   284 NSPSN-PSSSSVGLSTQSSQLVEQPEEEE 311
            .||.. ..|.||...|..|  :::..|||
Human   183 MSPLQIERSLSVHSGTTGS--LKRTHEEE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 38/112 (34%)
CDC14 <193..272 CDD:225297 29/78 (37%)
STYXNP_001124173.1 DSP_STYX 25..175 CDD:350372 39/121 (32%)
Interaction with FBXW7. /evidence=ECO:0000269|PubMed:28007894 76..78 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..223 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.