DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp12

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_071584.1 Gene:Dusp12 / 64014 RGDID:68375 Length:339 Species:Rattus norvegicus


Alignment Length:295 Identity:76/295 - (25%)
Similarity:119/295 - (40%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPS---SVGANCVLNVTCQS--P 168
            |.|....|.|.|.:|.|.:.:|..|.      |.||.......|.   ..|...||.|..:.  |
  Rat     8 NHGCERQAPTTSPASSAGHAVEVRPG------LYLGGAAAVAGPDYLREAGITAVLTVDSEPAFP 66

  Fly   169 NESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMR 233
            ..:..:||:.:.:||.|.|..::..:......||..||..|..||:|||||:|||..:..|::|:
  Rat    67 AGAGFEGLQSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVVTAFIMK 131

  Fly   234 YKSLSLLEAYKLVKVARPIISPNLNF---------MGQLLELEQNLRKSGVLAPAT---PHL-NS 285
            .:.|:..:||:.::..:|....|..|         ||..:.....:.|...|...|   |.| |.
  Rat   132 TEQLTFEKAYENLQTIKPEAKMNEGFEWQLKLYEAMGHEVHTSSAVYKQYRLQKVTEKYPELRNL 196

  Fly   286 PS-----NPSSSSVGLSTQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSL 345
            |.     :|::.|.||...    :.....:.:|....|......||              |||.:
  Rat   197 PRELFAVDPTTVSQGLKDD----ILYKCRKCRRSLFRRSSILDHSE--------------GSGPV 243

  Fly   346 AGSNCSSRLTSPPITPDDEAPSTSAAASSVSELDS 380
            |.::..:.|:| .:|..::|..||.....|..::|
  Rat   244 AFAHKRTGLSS-VLTTGNQAQCTSYFIEPVQWMES 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 41/147 (28%)
CDC14 <193..272 CDD:225297 25/87 (29%)
Dusp12NP_071584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 6/16 (38%)
DSPc 26..165 CDD:238073 40/144 (28%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9UNI6 115..120 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.