DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp10

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001099204.1 Gene:Dusp10 / 63995 RGDID:1310844 Length:482 Species:Rattus norvegicus


Alignment Length:391 Identity:117/391 - (29%)
Similarity:174/391 - (44%) Gaps:120/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETQSSSNNNSNNTTTATSTAR--------NNNSHNGRCECDGD-GDSVSHIQSEM---------- 51
            :||:.:   :...|||..|:.        |||.:.|.....|. |..||....::          
  Rat    93 QTQAIA---AGTATTAIGTSTTCPANQMVNNNENIGSLSPSGGVGSPVSGTPKQLASIKIIYPND 154

  Fly    52 ---------KMRIKREAPCLLLFMPIQNTNNNNRIGA---NQKDYPNKR---------------- 88
                     |..:..:.|.::...|....|.::..||   |..|..::|                
  Rat   155 LAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCR 219

  Fly    89 ----------SRENLACDEVTSTTS-----------------------------SSTAMN----- 109
                      |:|.:..||.|:..|                             ||...|     
  Rat   220 EGKDSFKRIFSKEIIVYDENTNEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHGNLC 284

  Fly   110 ------------GGGRTPA---LTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPSS---VG 156
                        |||.:.|   |.:|.  |:..|||:...:|:.|.|.|||.:||.|..:   :.
  Rat   285 DNSLQLQECREVGGGASAASSVLPQSV--PSTPDIESAELTPILPFLFLGNEQDAQDLDAMQRLN 347

  Fly   157 ANCVLNVTCQSPNESHLQGL-KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGI 220
            ...|:|||...|...:.:|| .|.::||:|:..||::|||:||::|||:|.:.|..:|:||.||:
  Rat   348 VGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGV 412

  Fly   221 SRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNS 285
            ||||||.|||:|::..:::.:|||.||..||||||||||||||||.|::| .:||    ||.:.:
  Rat   413 SRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDL-NNGV----TPRILT 472

  Fly   286 P 286
            |
  Rat   473 P 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 68/137 (50%)
CDC14 <193..272 CDD:225297 48/78 (62%)
Dusp10NP_001099204.1 DSP_MapKP 149..284 CDD:238723 18/134 (13%)
DSP_DUSP10 322..473 CDD:350415 74/155 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5280
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0006093
OrthoInspector 1 1.000 - - oto96939
orthoMCL 1 0.900 - - OOG6_107759
Panther 1 1.100 - - LDO PTHR10159
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5190
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.