DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp13a

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001103865.1 Gene:dusp13a / 568887 ZFINID:ZDB-GENE-080204-69 Length:189 Species:Danio rerio


Alignment Length:178 Identity:50/178 - (28%)
Similarity:83/178 - (46%) Gaps:27/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ALTRSCS--SPAVYDIE---------THPASPVFPHLLLGN---GRDADDPSSVGANCVLNVTCQ 166
            :|...|:  :|:|.:::         |...:.|:|::.:||   .||.....::|...::|....
Zfish     3 SLKELCAYETPSVAELQNFLLADRRPTGHVNHVWPNVYIGNEVAARDKPMLYNMGITHIVNAASG 67

  Fly   167 SPNESHL---------QGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISR 222
            .|   |:         ..:.|..:.|.|:....|..:|.....||..|.....||.:||..|:||
Zfish    68 PP---HVNTGPRFYRDMNIDYYGVEADDSFDFAISGFFYATARFIRAALSKNGRVFVHCLMGVSR 129

  Fly   223 SATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL 270
            |||:.:|::|..:.|:|:||.|.|:..|. |.||..|:.||..|:..|
Zfish   130 SATLVLAFLMICEDLTLMEAIKAVRQHRD-ICPNPGFLNQLRHLDMRL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 43/145 (30%)
CDC14 <193..272 CDD:225297 31/78 (40%)
dusp13aNP_001103865.1 DSPc 31..173 CDD:238073 43/145 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.