DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and si:ch211-121a2.2

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001098581.1 Gene:si:ch211-121a2.2 / 564515 ZFINID:ZDB-GENE-070705-21 Length:449 Species:Danio rerio


Alignment Length:331 Identity:82/331 - (24%)
Similarity:128/331 - (38%) Gaps:105/331 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QSSSNNNSNNTTTATSTARNNNSHNGRCECDGDGDSVSHIQSEMKMRIKREAPCLLLFMPIQNTN 72
            :|||.....||.|.|..  :.......|.   .|.|.|:|:|:    ||.|...|.:::|     
Zfish    11 KSSSAITEKNTPTETEV--DPADEGASCL---PGPSCSNIESQ----IKTELSLLEMYIP----- 61

  Fly    73 NNNRIGANQKDYPNKRSRENLACDEVTSTTSSSTAMNGGGRTPALTRSCSSPAVYDIETHPASPV 137
                                                :|.|:.....:.|:      ::..|.:.|
Zfish    62 ------------------------------------HGPGKLRNRLKECA------LDWTPVTEV 84

  Fly   138 FPHLLLGNGRDADDPS---SVGANCVLN-----VTCQS---PNESHLQG--LKYMQIPASDTPHQ 189
            :|::.|||...|.|.:   ::|...:||     |...:   |.|.|.||  :.|..:||.|....
Zfish    85 WPNVFLGNEETALDRAMLKTMGITHILNAAEIEVDLHANIIPRELHYQGMDITYYNVPALDEDMF 149

  Fly   190 NIKQYFQEAYDFIEDA-RKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPII 253
            :|.:||..|.:||..| ....::||:||..|:|||||:.:||:|....:.:..|...|...| .|
Zfish   150 DISEYFFPAAEFINKALSNPENKVLVHCVQGVSRSATLFLAYLMIQHDIMVENAIDHVTGVR-WI 213

  Fly   254 SPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSSSSVGLSTQSSQLVEQPEEEEKREQRER 318
            |||:.|:.||..|                                 :|.|||: .:.:.|||.:|
Zfish   214 SPNMGFLKQLTAL---------------------------------NSTLVEK-RKLQLREQLKR 244

  Fly   319 GKSKSD 324
            |...::
Zfish   245 GNEDTE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 51/147 (35%)
CDC14 <193..272 CDD:225297 30/79 (38%)
si:ch211-121a2.2NP_001098581.1 CDC14 61..244 CDD:225297 63/264 (24%)
DSPc 80..223 CDD:238073 49/143 (34%)
DSPc 284..438 CDD:238073
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.