DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and zgc:153981

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001071077.1 Gene:zgc:153981 / 563986 ZFINID:ZDB-GENE-061103-367 Length:184 Species:Danio rerio


Alignment Length:159 Identity:56/159 - (35%)
Similarity:88/159 - (55%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 IETHPASPVFPHLLLGNGRDADDPSS---VGANCVLNVTCQSP----NESHL-QGLKYMQIPASD 185
            ::..|...|:|:|.:||...|.:.::   :|...|||......    ::|:. ..:.|..|||.|
Zfish    25 LDLTPVDEVWPNLFIGNVAIAQNRNALKKMGITHVLNAAHSKQGSIGDQSYYGNSIVYYGIPAED 89

  Fly   186 TPHQNIKQYFQEAYDFIEDA-RKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVA 249
            :...::..||:.|.|||..| ||...:||:||..|:|||||:.:||:|..:.|:|..|.:.| |.
Zfish    90 SSSFDLSVYFKTASDFIHKALRKKNGKVLVHCIMGMSRSATLVLAYLMLRQRLTLRTAIQTV-VL 153

  Fly   250 RPIISPNLNFMGQLLELEQNLRKSGVLAP 278
            |..|.||.||:..||:|:..|::..:|.|
Zfish   154 RRAIYPNRNFLSLLLDLDIQLQRKRMLCP 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 52/142 (37%)
CDC14 <193..272 CDD:225297 37/79 (47%)
zgc:153981NP_001071077.1 DSPc 29..163 CDD:238073 48/134 (36%)
CDC14 <78..155 CDD:225297 32/77 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.