DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp5

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001015856.1 Gene:dusp5 / 548573 XenbaseID:XB-GENE-957572 Length:375 Species:Xenopus tropicalis


Alignment Length:249 Identity:81/249 - (32%)
Similarity:123/249 - (49%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QSEMKMRIKREAPCLLLFMPIQNTNNNNRIGAN-----------QKDYPNKRSRENLACDEVTST 101
            :|:...::|:|:...:    :.||..:..:|..           :.:||.....:|.:.:|...|
 Frog    88 RSQRWQKLKKESTARI----VLNTLGSLPLGPRICFLKGGYESFRAEYPECCIDQNQSAEEENET 148

  Fly   102 TSSSTAMNGGGRTPAL-TRSCSSP-AVYDIETHPASPV--FPHLLLGNGRDA---DDPSSVGANC 159
            .          |.|.| .|..|.| ..||    ..|||  .|.|.||:...|   :..:::....
 Frog   149 E----------RNPRLGDRLTSFPKPSYD----QGSPVEILPFLYLGSAYHASRCEFLANLHITA 199

  Fly   160 VLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSA 224
            :|||:.:|.::...:...|..||..|....:|..:||||.|||:..::.|.|||:||.||||||.
 Frog   200 LLNVSRKSSSDLCKEQYSYKWIPVEDNHTADISSHFQEAIDFIDTIKRAGGRVLVHCEAGISRSP 264

  Fly   225 TIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAP 278
            ||.:||:|:.:...|.||::.:|..|.:||||.:||||||..|..:..|.||||
 Frog   265 TICMAYLMKTRRFRLEEAFEYIKQRRSLISPNFSFMGQLLHYESEIFPSKVLAP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 56/138 (41%)
CDC14 <193..272 CDD:225297 40/78 (51%)
dusp5NP_001015856.1 DSP_MapKP 6..135 CDD:238723 8/50 (16%)
DSP_DUSP5 171..309 CDD:350487 56/137 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.