DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and STYXL1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_016867785.1 Gene:STYXL1 / 51657 HGNCID:18165 Length:351 Species:Homo sapiens


Alignment Length:147 Identity:41/147 - (27%)
Similarity:62/147 - (42%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YDIETHPASPVFPHLLLGNGRDADDP---SSVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPH 188
            |.||..|..     :.:||...|.||   ..:.....:||:..:.........|.:.|...|:|.
Human   197 YPIEIVPGK-----VFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPE 256

  Fly   189 QNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPII 253
            ..|..:.:....|||.....||.:|:....|||||....|||:|.....:|..::..||..:..:
Human   257 AQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNM 321

  Fly   254 SPNLNFMGQLLELEQNL 270
            .||...:.||||.|:.:
Human   322 CPNRGLVSQLLEWEKTI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 37/136 (27%)
CDC14 <193..272 CDD:225297 25/78 (32%)
STYXL1XP_016867785.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.