DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp27

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001178858.1 Gene:Dusp27 / 498267 RGDID:1560598 Length:1137 Species:Rattus norvegicus


Alignment Length:284 Identity:70/284 - (24%)
Similarity:124/284 - (43%) Gaps:82/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SSPAVYDIE-----------THPASPVFPHLLLGNGRDADDP---SSVGANCVLNVTCQSPNESH 172
            ::|.|.|::           .:....|:|::.:.....|.:.   ..:|...:||.       :|
  Rat   111 NTPCVLDLQRALIQDRQEAPRNEVDEVWPNVFIAEKSVAVNKGRLKRLGITHILNA-------AH 168

  Fly   173 LQG------------LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKT-GSRVLLHCHAGISRSA 224
            ..|            ::|:.:...|.|..:|.|:|::|.:|:::|..| ..:||:....||||||
  Rat   169 GTGVYTGPEFYTGLEIQYLGVEVDDFPEVDISQHFRKAAEFLDEALLTYRGKVLVSSEMGISRSA 233

  Fly   225 TIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL------------------- 270
            .:.:||:|.:.::::|||...|:..|.|. ||..|:.||.||.:.|                   
  Rat   234 VLVVAYLMIFHNMAILEALMTVRRKRAIY-PNDGFLKQLRELNEKLMEEREEEDDEEEPEEDAGS 297

  Fly   271 ----RKSGVLA----PATPHLNSPSNPSSSSVGLSTQSSQ---LVEQPEEEEKRE---------- 314
                |.:.::.    .||.||      |.||:|.::|.||   |:::.|||...|          
  Rat   298 TLGARVNSLMVEEEDDATSHL------SGSSLGKASQVSQPVTLIDEEEEERLYEEWRKGQGFPK 356

  Fly   315 -QRERGKSKSDSEAMDEDGFDYDD 337
             :..:|:..|.|.:.::||.|.:|
  Rat   357 AEASQGRKGSCSASSEQDGDDCED 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 41/149 (28%)
CDC14 <193..272 CDD:225297 31/102 (30%)
Dusp27NP_001178858.1 DSPc 133..275 CDD:238073 41/149 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.