DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp3

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_006247464.1 Gene:Dusp3 / 498003 RGDID:1560049 Length:212 Species:Rattus norvegicus


Alignment Length:162 Identity:56/162 - (34%)
Similarity:81/162 - (50%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YDIETHPASPVFPHLLLGNGRDADDPS---SVGANCVLNVTCQSPNESHLQ---------GLKYM 179
            |.:.:.|.:.|.|.:.:||...|.|.:   .:|...||| ..:..:..|:.         |:.||
  Rat    49 YSLPSQPCNEVIPRVYVGNASVAQDITQLQKLGITHVLN-AAEGRSFMHVNTSASFYKDTGITYM 112

  Fly   180 QIPASDTPHQNIKQYFQEAYDFIED--ARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEA 242
            .|.|:||...|:..||:.|.|||:.  |.|.| |||:||..|.|||.|:.|||:|..:.:.:..|
  Rat   113 GIKANDTQEFNLSAYFERAADFIDQALAHKNG-RVLVHCREGYSRSPTLVIAYLMLRQKMDVRSA 176

  Fly   243 YKLVKVARPIISPNLNFMGQLLELEQNLRKSG 274
            ...|:..|. |.||..|:.||.:|...|.:.|
  Rat   177 LSTVRQNRE-IGPNDGFLAQLCQLNDRLAEEG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 52/147 (35%)
CDC14 <193..272 CDD:225297 34/80 (43%)
Dusp3XP_006247464.1 DSPc 55..200 CDD:238073 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.